PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g040563m
Common NameCISIN_1g040563mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 305aa    MW: 33105.9 Da    PI: 5.6183
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g040563mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS71.61.5e-22210305199
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+a+s+++ +  ++l+++ +  +s  g+p+qRl ay++eAL ar  +s+s++y+al+++e +   s++ l+++++++e++P+lk
  orange1.1g040563m 210 LKQLLIACAKALSENNINDFDKLIEKARGAVSVGGEPIQRLGAYMVEALVARKEKSGSNIYRALRCREPE---SKDLLSYMHILYEICPYLK 298
                        689******************************************************************9...9****************** PP

               GRAS  93 fshltaN 99 
                        f++++aN
  orange1.1g040563m 299 FGYMAAN 305
                        ******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.674184305IPR005202Transcription factor GRAS
PfamPF035145.3E-20210305IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MDSRQIIGCG VTSAGISYSS SCPTVPSIPN RLFGPLKFDV GNSPNSPFSN QFECDTITSL  60
SDSQEQHSPS DNPSGLSPSC DSSLESNSYF HQLSPAVDSL ILFSGGTSYL QNANSSQKIK  120
HVLQELETVL MGPDEEEAAK PNTSYGGSSK PQAPGDRPRS WSQEHHGSHV IQPQPSFISR  180
YRQSAEGAQI ENSQMAIGES SLQGFPSGNL KQLLIACAKA LSENNINDFD KLIEKARGAV  240
SVGGEPIQRL GAYMVEALVA RKEKSGSNIY RALRCREPES KDLLSYMHIL YEICPYLKFG  300
YMAAN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006452128.10.0hypothetical protein CICLE_v10007843mg
RefseqXP_006475287.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1-like
TrEMBLA0A067DFT90.0A0A067DFT9_CITSI; Uncharacterized protein (Fragment)
STRINGVIT_19s0014g04940.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145381022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.23e-37GRAS family protein